SCOPe 2.08: Domain d1ojab2: 1oja B:290-401

Lineage for d1ojab2 (1oja B:290-401)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Monoamine oxidase B [69673] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69674] (46 PDB entries)

8. Domain d1ojab2: 1oja B:290-401 [93099]
   Other proteins in same PDB: d1ojaa1, d1ojab1
   complexed with fad, isn

Details for d1ojab2

PDB Entry: 1oja, 1.7 Å

PDB Description: human monoamine oxidase b in complex with isatin

PDB Compounds: (B:) amine oxidase [flavin-containing] b

SCOPe Domain Sequences for d1ojab2:

Sequence; same for both SEQRES and ATOM records:

>d1ojab2 d.16.1.5 (B:290-401) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

Timeline for d1ojab2:

• d1ojab2 first appeared in SCOP 1.67
  
• d1ojab2 appears in SCOPe 2.07