Lineage for d1oj6d_ (1oj6 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1976410Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1976411Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1976495Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1978605Protein Neuroglobin [100978] (2 species)
  7. 1978606Species Human (Homo sapiens) [TaxId:9606] [100979] (2 PDB entries)
  8. 1978610Domain d1oj6d_: 1oj6 D: [93091]
    complexed with hem, so4

Details for d1oj6d_

PDB Entry: 1oj6 (more details), 1.95 Å

PDB Description: human brain neuroglobin three-dimensional structure
PDB Compounds: (D:) neuroglobin

SCOPe Domain Sequences for d1oj6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj6d_ a.1.1.2 (D:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]}
merpepelirqswravsrsplehgtvlfarlfalepdllplfqyngrqfsspedslsspe
fldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymleks
lgpaftpatraawsqlygavvqamsrgwdg

SCOPe Domain Coordinates for d1oj6d_:

Click to download the PDB-style file with coordinates for d1oj6d_.
(The format of our PDB-style files is described here.)

Timeline for d1oj6d_: