SCOPe 2.03: Domain d1oj6d_: 1oj6 D:

Lineage for d1oj6d_ (1oj6 D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Neuroglobin [100978] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [100979] (2 PDB entries)

8. Domain d1oj6d_: 1oj6 D: [93091]
   complexed with hem, so4

Details for d1oj6d_

PDB Entry: 1oj6, 1.95 Å

PDB Description: human brain neuroglobin three-dimensional structure

PDB Compounds: (D:) neuroglobin

SCOPe Domain Sequences for d1oj6d_:

Sequence; same for both SEQRES and ATOM records:

>d1oj6d_ a.1.1.2 (D:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]}
merpepelirqswravsrsplehgtvlfarlfalepdllplfqyngrqfsspedslsspe
fldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymleks
lgpaftpatraawsqlygavvqamsrgwdg

Timeline for d1oj6d_:

• d1oj6d_ first appeared in SCOP 1.67
  
• d1oj6d_ appears in SCOPe 2.02
  
• d1oj6d_ appears in SCOPe 2.04
  
• d1oj6d_ appears in the current release, SCOPe 2.08