Class a: All alpha proteins [46456] (284 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Neuroglobin [100978] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [100979] (2 PDB entries) |
Domain d1oj6c_: 1oj6 C: [93090] complexed with hem, so4 |
PDB Entry: 1oj6 (more details), 1.95 Å
SCOPe Domain Sequences for d1oj6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oj6c_ a.1.1.2 (C:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]} pepelirqswravsrsplehgtvlfarlfalepdllplfqyngrqfsspedslsspefld hirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekslgp aftpatraawsqlygavvqamsrgwdge
Timeline for d1oj6c_: