Lineage for d1oj6c_ (1oj6 C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 349260Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 349261Superfamily a.1.1: Globin-like [46458] (4 families) (S)
  5. 349289Family a.1.1.2: Globins [46463] (20 proteins)
    Heme-binding protein
  6. 350308Protein Neuroglobin [100978] (1 species)
  7. 350309Species Human (Homo sapiens) [TaxId:9606] [100979] (1 PDB entry)
  8. 350312Domain d1oj6c_: 1oj6 C: [93090]

Details for d1oj6c_

PDB Entry: 1oj6 (more details), 1.95 Å

PDB Description: human brain neuroglobin three-dimensional structure

SCOP Domain Sequences for d1oj6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj6c_ a.1.1.2 (C:) Neuroglobin {Human (Homo sapiens)}
pepelirqswravsrsplehgtvlfarlfalepdllplfqyngrqfsspedslsspefld
hirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekslgp
aftpatraawsqlygavvqamsrgwdge

SCOP Domain Coordinates for d1oj6c_:

Click to download the PDB-style file with coordinates for d1oj6c_.
(The format of our PDB-style files is described here.)

Timeline for d1oj6c_: