Lineage for d1oj5a_ (1oj5 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2576610Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2576905Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2577142Family d.110.3.8: PAS domain of steroid receptor coactivator 1A, NCo-A1 [103187] (2 proteins)
  6. 2577143Protein PAS domain of steroid receptor coactivator 1A, NCo-A1 [103188] (1 species)
  7. 2577144Species Mouse (Mus musculus) [TaxId:10090] [103189] (2 PDB entries)
  8. 2577145Domain d1oj5a_: 1oj5 A: [93087]
    PAS-B domain; complexed with a lxxll motif peptide, chain B
    complexed with iod

Details for d1oj5a_

PDB Entry: 1oj5 (more details), 2.2 Å

PDB Description: crystal structure of the nco-a1 pas-b domain bound to the stat6 transactivation domain lxxll motif
PDB Compounds: (A:) steroid receptor coactivator 1a

SCOPe Domain Sequences for d1oj5a_:

Sequence, based on SEQRES records: (download)

>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]}
vesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqevm
trgtasspsyrfilndgtmlsahtrcklcypqspdmqpfimgihiidre

Sequence, based on observed residues (ATOM records): (download)

>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]}
vesfmtkqdttgkiisidtsslraagrtgwedlvrkciyaffqpqgrepsyarqlfqevm
trgtasspsyrfilndgtmlsahtrcklcypmqpfimgihiidre

SCOPe Domain Coordinates for d1oj5a_:

Click to download the PDB-style file with coordinates for d1oj5a_.
(The format of our PDB-style files is described here.)

Timeline for d1oj5a_: