SCOP 1.73: Domain d1oj4b2: 1oj4 B:164-283

Lineage for d1oj4b2 (1oj4 B:164-283)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein)

6. Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species)

7. Species Escherichia coli [TaxId:562] [103015] (1 PDB entry)

8. Domain d1oj4b2: 1oj4 B:164-283 [93086]
   Other proteins in same PDB: d1oj4a1, d1oj4b1
   complexed with anp, cdm, cl

Details for d1oj4b2

PDB Entry: 1oj4, 2.01 Å

PDB Description: ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

PDB Compounds: (B:) 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

SCOP Domain Sequences for d1oj4b2:

Sequence; same for both SEQRES and ATOM records:

>d1oj4b2 d.58.26.5 (B:164-283) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]}
dppekwylvahpgvsiptpvifkdpelprntpkrsietllkcefsndceviarkrfrevd
avlswlleyapsrltgtgacvfaefdtesearqvleqapewlngfvakgvnlsplhraml

Timeline for d1oj4b2:

• d1oj4b2 first appeared in SCOP 1.67
  
• d1oj4b2 appears in SCOP 1.71
  
• d1oj4b2 appears in SCOP 1.75
  
• d1oj4b2 appears in the current release, SCOPe 2.08