Lineage for d1oj4b2 (1oj4 B:164-283)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954566Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2954614Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein)
  6. 2954615Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species)
  7. 2954616Species Escherichia coli [TaxId:562] [103015] (2 PDB entries)
  8. 2954620Domain d1oj4b2: 1oj4 B:164-283 [93086]
    Other proteins in same PDB: d1oj4a1, d1oj4b1
    complexed with anp, cdm, cl

Details for d1oj4b2

PDB Entry: 1oj4 (more details), 2.01 Å

PDB Description: ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase
PDB Compounds: (B:) 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

SCOPe Domain Sequences for d1oj4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj4b2 d.58.26.5 (B:164-283) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]}
dppekwylvahpgvsiptpvifkdpelprntpkrsietllkcefsndceviarkrfrevd
avlswlleyapsrltgtgacvfaefdtesearqvleqapewlngfvakgvnlsplhraml

SCOPe Domain Coordinates for d1oj4b2:

Click to download the PDB-style file with coordinates for d1oj4b2.
(The format of our PDB-style files is described here.)

Timeline for d1oj4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oj4b1