SCOPe 2.07: Domain d1oj4b1: 1oj4 B:1-163

Lineage for d1oj4b1 (1oj4 B:1-163)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)

6. Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89822] (2 species)

7. Species Escherichia coli [TaxId:562] [102765] (2 PDB entries)

8. Domain d1oj4b1: 1oj4 B:1-163 [93085]
   Other proteins in same PDB: d1oj4a2, d1oj4b2
   complexed with anp, cdm, cl

Details for d1oj4b1

PDB Entry: 1oj4, 2.01 Å

PDB Description: ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

PDB Compounds: (B:) 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

SCOPe Domain Sequences for d1oj4b1:

Sequence; same for both SEQRES and ATOM records:

>d1oj4b1 d.14.1.5 (B:1-163) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]}
mrtqwpspaklnlflyitgqradgyhtlqtlfqfldygdtisielrddgdirlltpvegv
ehednlivraarllmktaadsgrlptgsganisidkrlpmggglgggssnaatvlvalnh
lwqcglsmdelaemgltlgadvpvfvrghaafaegvgeiltpv

Timeline for d1oj4b1:

• d1oj4b1 first appeared in SCOP 1.67
  
• d1oj4b1 appears in SCOPe 2.06
  
• d1oj4b1 appears in the current release, SCOPe 2.08