Lineage for d1oj4b1 (1oj4 B:1-163)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407595Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 407596Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 407731Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (6 proteins)
  6. 407732Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89822] (2 species)
  7. 407733Species Escherichia coli [TaxId:562] [102765] (1 PDB entry)
  8. 407735Domain d1oj4b1: 1oj4 B:1-163 [93085]
    Other proteins in same PDB: d1oj4a2, d1oj4b2
    complexed with anp, cdm, cl

Details for d1oj4b1

PDB Entry: 1oj4 (more details), 2.01 Å

PDB Description: ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

SCOP Domain Sequences for d1oj4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj4b1 d.14.1.5 (B:1-163) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli}
mrtqwpspaklnlflyitgqradgyhtlqtlfqfldygdtisielrddgdirlltpvegv
ehednlivraarllmktaadsgrlptgsganisidkrlpmggglgggssnaatvlvalnh
lwqcglsmdelaemgltlgadvpvfvrghaafaegvgeiltpv

SCOP Domain Coordinates for d1oj4b1:

Click to download the PDB-style file with coordinates for d1oj4b1.
(The format of our PDB-style files is described here.)

Timeline for d1oj4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oj4b2