Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein) |
Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species) |
Species Escherichia coli [TaxId:562] [103015] (2 PDB entries) |
Domain d1oj4a2: 1oj4 A:164-283 [93084] Other proteins in same PDB: d1oj4a1, d1oj4b1 complexed with anp, cdm, cl |
PDB Entry: 1oj4 (more details), 2.01 Å
SCOPe Domain Sequences for d1oj4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oj4a2 d.58.26.5 (A:164-283) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli [TaxId: 562]} dppekwylvahpgvsiptpvifkdpelprntpkrsietllkcefsndceviarkrfrevd avlswlleyapsrltgtgacvfaefdtesearqvleqapewlngfvakgvnlsplhraml
Timeline for d1oj4a2: