Lineage for d1oj4a2 (1oj4 A:164-283)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505236Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families) (S)
    common fold is elaborated with additional secondary structures
  5. 505274Family d.58.26.5: 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89950] (1 protein)
  6. 505275Protein 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE [89951] (2 species)
  7. 505276Species Escherichia coli [TaxId:562] [103015] (1 PDB entry)
  8. 505277Domain d1oj4a2: 1oj4 A:164-283 [93084]
    Other proteins in same PDB: d1oj4a1, d1oj4b1

Details for d1oj4a2

PDB Entry: 1oj4 (more details), 2.01 Å

PDB Description: ternary complex of 4-diphosphocytidyl-2-c-methyl-d-erythritol kinase

SCOP Domain Sequences for d1oj4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oj4a2 d.58.26.5 (A:164-283) 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE {Escherichia coli}
dppekwylvahpgvsiptpvifkdpelprntpkrsietllkcefsndceviarkrfrevd
avlswlleyapsrltgtgacvfaefdtesearqvleqapewlngfvakgvnlsplhraml

SCOP Domain Coordinates for d1oj4a2:

Click to download the PDB-style file with coordinates for d1oj4a2.
(The format of our PDB-style files is described here.)

Timeline for d1oj4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oj4a1