Lineage for d1oizb2 (1oiz B:91-275)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2111988Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
    core: 4 turns of a (beta-alpha)n superhelix
  4. 2111989Superfamily c.13.1: CRAL/TRIO domain [52087] (2 families) (S)
    automatically mapped to Pfam PF00650
  5. 2111990Family c.13.1.1: CRAL/TRIO domain [52088] (4 proteins)
    Pfam PF00650
  6. 2111991Protein Alpha-tocopherol transfer protein [102203] (1 species)
  7. 2111992Species Human (Homo sapiens) [TaxId:9606] [102204] (3 PDB entries)
  8. 2111995Domain d1oizb2: 1oiz B:91-275 [93082]
    Other proteins in same PDB: d1oiza1, d1oizb1
    complexed with trt

Details for d1oizb2

PDB Entry: 1oiz (more details), 1.88 Å

PDB Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein
PDB Compounds: (B:) alpha-tocopherol transfer protein

SCOPe Domain Sequences for d1oizb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oizb2 c.13.1.1 (B:91-275) Alpha-tocopherol transfer protein {Human (Homo sapiens) [TaxId: 9606]}
siigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitselivqevetq
rngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi
kpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfimksedyl
ssise

SCOPe Domain Coordinates for d1oizb2:

Click to download the PDB-style file with coordinates for d1oizb2.
(The format of our PDB-style files is described here.)

Timeline for d1oizb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oizb1