SCOP 1.69: Domain d1oizb2: 1oiz B:91-275

Lineage for d1oizb2 (1oiz B:91-275)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.13: SpoIIaa-like [52086] (2 superfamilies)
   core: 4 turns of a (beta-alpha)n superhelix

4. Superfamily c.13.1: CRAL/TRIO domain [52087] (1 family)

5. Family c.13.1.1: CRAL/TRIO domain [52088] (3 proteins)
   Pfam 00650

6. Protein Alpha-tocopherol transfer protein [102203] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102204] (3 PDB entries)

8. Domain d1oizb2: 1oiz B:91-275 [93082]
   Other proteins in same PDB: d1oiza1, d1oizb1

Details for d1oizb2

PDB Entry: 1oiz, 1.88 Å

PDB Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein

SCOP Domain Sequences for d1oizb2:

Sequence; same for both SEQRES and ATOM records:

>d1oizb2 c.13.1.1 (B:91-275) Alpha-tocopherol transfer protein {Human (Homo sapiens)}
siigllkagyhgvlrsrdptgskvliyriahwdpkvftaydvfrvslitselivqevetq
rngikaifdlegwqfshafqitpsvakkiaavltdsfplkvrgihlinepvifhavfsmi
kpfltekikerihmhgnnykqsllqhfpdilpleyggeefsmedicqewtnfimksedyl
ssise

Timeline for d1oizb2:

• d1oizb2 first appeared in SCOP 1.67
  
• d1oizb2 appears in SCOP 1.71
  
• d1oizb2 appears in the current release, SCOPe 2.08