Lineage for d1oipa1 (1oip A:25-90)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985559Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 1985560Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins)
  6. 1985561Protein Alpha-tocopherol transfer protein [101069] (1 species)
  7. 1985562Species Human (Homo sapiens) [TaxId:9606] [101070] (3 PDB entries)
  8. 1985566Domain d1oipa1: 1oip A:25-90 [93071]
    Other proteins in same PDB: d1oipa2
    complexed with so4, viv

Details for d1oipa1

PDB Entry: 1oip (more details), 1.95 Å

PDB Description: the molecular basis of vitamin e retention: structure of human alpha-tocopherol transfer protein
PDB Compounds: (A:) alpha-tocopherol transfer protein

SCOPe Domain Sequences for d1oipa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oipa1 a.5.3.1 (A:25-90) Alpha-tocopherol transfer protein {Human (Homo sapiens) [TaxId: 9606]}
qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis
adlhpr

SCOPe Domain Coordinates for d1oipa1:

Click to download the PDB-style file with coordinates for d1oipa1.
(The format of our PDB-style files is described here.)

Timeline for d1oipa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oipa2