Class a: All alpha proteins [46456] (289 folds) |
Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) |
Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 proteins) |
Protein Alpha-tocopherol transfer protein [101069] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101070] (3 PDB entries) |
Domain d1oipa1: 1oip A:25-90 [93071] Other proteins in same PDB: d1oipa2 complexed with so4, viv |
PDB Entry: 1oip (more details), 1.95 Å
SCOPe Domain Sequences for d1oipa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oipa1 a.5.3.1 (A:25-90) Alpha-tocopherol transfer protein {Human (Homo sapiens) [TaxId: 9606]} qpglaalrrrareagvplaplpltdsfllrflrardfdldlawrllknyykwraecpeis adlhpr
Timeline for d1oipa1: