Lineage for d1oiob_ (1oio B:)
- Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
Superfamily b.2.3: Bacterial adhesins [49401] (5 families) 
Family b.2.3.5: F17c-type adhesin [89215] (2 proteins) 
Protein Fimbrial lectin GafD [101552] (1 species) Species Escherichia coli [TaxId:562] [101553] (1 PDB entry) 
Domain d1oiob_: 1oio B: [93070]
complexed with nag
Details for d1oiob_
PDB Entry: 1oio (more details), 1.7 Å
PDB Description: gafd (f17c-type) fimbrial adhesin from escherichia coli
SCOP Domain Sequences for d1oiob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oiob_ b.2.3.5 (B:) Fimbrial lectin GafD {Escherichia coli}
avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt
SCOP Domain Coordinates for d1oiob_:
Click to download the PDB-style file with coordinates for d1oiob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oiob_:
- d1oiob_ is new in SCOP 1.67
- d1oiob_ appears in SCOP 1.69
- d1oiob_ appears in the current release, SCOPe 2.08
View in 3D
