SCOPe 2.07: Domain d1oioa_: 1oio A:

Lineage for d1oioa_ (1oio A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.5: F17c-type adhesin [89215] (3 proteins)
   automatically mapped to Pfam PF09222

6. Protein Fimbrial lectin GafD [101552] (1 species)

7. Species Escherichia coli [TaxId:562] [101553] (1 PDB entry)

8. Domain d1oioa_: 1oio A: [93069]
   complexed with nag

Details for d1oioa_

PDB Entry: 1oio, 1.7 Å

PDB Description: gafd (f17c-type) fimbrial adhesin from escherichia coli

PDB Compounds: (A:) fimbrial lectin

SCOPe Domain Sequences for d1oioa_:

Sequence; same for both SEQRES and ATOM records:

>d1oioa_ b.2.3.5 (A:) Fimbrial lectin GafD {Escherichia coli [TaxId: 562]}
avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt

Timeline for d1oioa_:

• d1oioa_ first appeared in SCOP 1.67
  
• d1oioa_ appears in SCOPe 2.06
  
• d1oioa_ appears in the current release, SCOPe 2.08