Lineage for d1oioa_ (1oio A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368237Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (8 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 368306Superfamily b.2.3: Bacterial adhesins [49401] (5 families) (S)
  5. 368400Family b.2.3.5: F17c-type adhesin [89215] (2 proteins)
  6. 368406Protein Fimbrial lectin GafD [101552] (1 species)
  7. 368407Species Escherichia coli [TaxId:562] [101553] (1 PDB entry)
  8. 368408Domain d1oioa_: 1oio A: [93069]

Details for d1oioa_

PDB Entry: 1oio (more details), 1.7 Å

PDB Description: gafd (f17c-type) fimbrial adhesin from escherichia coli

SCOP Domain Sequences for d1oioa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oioa_ b.2.3.5 (A:) Fimbrial lectin GafD {Escherichia coli}
avsfigstendvgpsqgsyssthamdnlpfvyntgynigyqnanvwrisggfcvgldgkv
dlpvvgsldgqsiyglteevglliwmgdtnysrgtamsgnswenvfsgwcvgnyvstqgl
svhvrpvilkrnssaqysvqktsigsirmrpyngssagsvqttvnfslnpftlndtvt

SCOP Domain Coordinates for d1oioa_:

Click to download the PDB-style file with coordinates for d1oioa_.
(The format of our PDB-style files is described here.)

Timeline for d1oioa_: