SCOPe 2.05: Domain d1oika_: 1oik A:

Lineage for d1oika_ (1oik A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families)
   Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold

5. Family b.82.2.5: TauD/TfdA-like [75038] (3 proteins)
   automatically mapped to Pfam PF02668

6. Protein Putative alkylsulfatase AtsK [101989] (1 species)

7. Species Pseudomonas putida [TaxId:303] [101990] (6 PDB entries)
   Uniprot Q9WWU5

8. Domain d1oika_: 1oik A: [93063]
   complexed with akg, c26, fe2

Details for d1oika_

PDB Entry: 1oik, 2.06 Å

PDB Description: crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with fe, alphaketoglutarate and 2-ethyl-1-hexanesulfuric acid

PDB Compounds: (A:) putative alkylsulfatase atsk

SCOPe Domain Sequences for d1oika_:

Sequence, based on SEQRES records:

>d1oika_ b.82.2.5 (A:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg
gdtvwantaaayqelpeplreladklwavhsnrydyaslkpdidpaklerhrkvftstvy
etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag
dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr

Sequence, based on observed residues (ATOM records):

>d1oika_ b.82.2.5 (A:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelpeplre
ladklwavhsnryetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvt
rlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr

Timeline for d1oika_:

• d1oika_ first appeared in SCOP 1.67
  
• d1oika_ appears in SCOPe 2.04
  
• d1oika_ appears in SCOPe 2.06
  
• d1oika_ appears in the current release, SCOPe 2.08