Lineage for d1oijd_ (1oij D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677266Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 677672Superfamily b.82.2: Clavaminate synthase-like [51197] (12 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 677749Family b.82.2.5: TauD/TfdA-like [75038] (2 proteins)
  6. 677750Protein Putative alkylsulfatase AtsK [101989] (1 species)
  7. 677751Species Pseudomonas putida [TaxId:303] [101990] (6 PDB entries)
  8. 677759Domain d1oijd_: 1oij D: [93062]
    complexed with akg, na

Details for d1oijd_

PDB Entry: 1oij (more details), 2.1 Å

PDB Description: crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate
PDB Compounds: (D:) putative alkylsulfatase atsk

SCOP Domain Sequences for d1oijd_:

Sequence, based on SEQRES records: (download)

>d1oijd_ b.82.2.5 (D:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg
gdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpaklerhrkvftstvy
etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag
dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr

Sequence, based on observed residues (ATOM records): (download)

>d1oijd_ b.82.2.5 (D:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvanswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelpeplrelad
klwavhsnyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlen
tvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr

SCOP Domain Coordinates for d1oijd_:

Click to download the PDB-style file with coordinates for d1oijd_.
(The format of our PDB-style files is described here.)

Timeline for d1oijd_: