Lineage for d1oijc_ (1oij C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2423914Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2424882Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2425027Family b.82.2.5: TauD/TfdA-like [75038] (5 proteins)
    automatically mapped to Pfam PF02668
  6. 2425042Protein Putative alkylsulfatase AtsK [101989] (1 species)
  7. 2425043Species Pseudomonas putida [TaxId:303] [101990] (6 PDB entries)
    Uniprot Q9WWU5
  8. 2425050Domain d1oijc_: 1oij C: [93061]
    complexed with akg, na

Details for d1oijc_

PDB Entry: 1oij (more details), 2.1 Å

PDB Description: crystal structure of the alkylsulfatase atsk, a non-heme fe(ii) alphaketoglutarate dependent dioxygenase in complex with alphaketoglutarate
PDB Compounds: (C:) putative alkylsulfatase atsk

SCOPe Domain Sequences for d1oijc_:

Sequence, based on SEQRES records: (download)

>d1oijc_ b.82.2.5 (C:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg
gdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpaklerhrkvftstvy
etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag
dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgylsrttr

Sequence, based on observed residues (ATOM records): (download)

>d1oijc_ b.82.2.5 (C:) Putative alkylsulfatase AtsK {Pseudomonas putida [TaxId: 303]}
leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa
kllgepvranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqelpeplrela
dklwavhsneyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrl
entvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgylsrttr

SCOPe Domain Coordinates for d1oijc_:

Click to download the PDB-style file with coordinates for d1oijc_.
(The format of our PDB-style files is described here.)

Timeline for d1oijc_: