![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.2: Clavaminate synthase-like [51197] (8 families) ![]() Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
![]() | Family b.82.2.5: TauD/TfdA-like [75038] (2 proteins) |
![]() | Protein Putative alkylsulfatase AtsK [101989] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [101990] (4 PDB entries) |
![]() | Domain d1oiid_: 1oii D: [93058] complexed with akg, fe2 |
PDB Entry: 1oii (more details), 2.19 Å
SCOP Domain Sequences for d1oiid_:
Sequence, based on SEQRES records: (download)
>d1oiid_ b.82.2.5 (D:) Putative alkylsulfatase AtsK {Pseudomonas putida} leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa kllgepvahptvpvvdgtryllqldgaqgqranswhtdvtfveaypkasilrsvvapasg gdtvwantaaayqelpeplreladklwavhsneydyaslkpdidpaklerhrkvftstvy etehpvvrvhpisgeralqlghfvkrikgysladsqhlfavlqghvtrlentvrwrweag dvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgqlsrttr
>d1oiid_ b.82.2.5 (D:) Putative alkylsulfatase AtsK {Pseudomonas putida} leldvhpvagrigaeirgvklspdldaatveaiqaalvrhkviffrgqthlddqsqegfa kllgepvtryllqldranswhtdvtfveaypkasilrsvvapasggdtvwantaaayqel peplreladklwavhsnyetehpvvrvhpisgeralqlghfvkrikgysladsqhlfavl qghvtrlentvrwrweagdvaiwdnratqhyavddygtqprivrrvtlagevpvgvdgql srttr
Timeline for d1oiid_: