Lineage for d1oifb_ (1oif B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082968Species Thermotoga maritima [TaxId:2336] [89475] (8 PDB entries)
    Uniprot Q08638
  8. 2082980Domain d1oifb_: 1oif B: [93050]
    complexed with ifm

Details for d1oifb_

PDB Entry: 1oif (more details), 2.12 Å

PDB Description: family 1 b-glucosidase from thermotoga maritima
PDB Compounds: (B:) Beta-glucosidase

SCOPe Domain Sequences for d1oifb_:

Sequence, based on SEQRES records: (download)

>d1oifb_ c.1.8.4 (B:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
pgmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrf
mhqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvk
fdpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvs
edgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdy
stqkrivkdsgywysnvvknngle

Sequence, based on observed residues (ATOM records): (download)

>d1oifb_ c.1.8.4 (B:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
nvkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrw
kedieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyh
wdlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvha
pgmrdiyvafravhnllraharavkvfretvdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdaakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvsed
grvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdyst
qkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d1oifb_:

Click to download the PDB-style file with coordinates for d1oifb_.
(The format of our PDB-style files is described here.)

Timeline for d1oifb_: