![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 proteins) |
![]() | Protein Beta-glucosidase A [51528] (9 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [89475] (6 PDB entries) Uniprot Q08638 |
![]() | Domain d1oifa_: 1oif A: [93049] complexed with ifm |
PDB Entry: 1oif (more details), 2.12 Å
SCOPe Domain Sequences for d1oifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oifa_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys tqkrivkdsgywysnvvknngled
Timeline for d1oifa_: