Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) |
Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (4 proteins) |
Protein Beta-glucosidase A [51528] (6 species) |
Species Thermotoga maritima [TaxId:243274] [89475] (5 PDB entries) |
Domain d1oifa_: 1oif A: [93049] |
PDB Entry: 1oif (more details), 2.12 Å
SCOP Domain Sequences for d1oifa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oifa_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima} vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys tqkrivkdsgywysnvvknngled
Timeline for d1oifa_: