Lineage for d1oi0c_ (1oi0 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918897Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2918898Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2918909Protein Hypothetical protein AF2198 [102714] (1 species)
  7. 2918910Species Archaeoglobus fulgidus [TaxId:2234] [102715] (2 PDB entries)
  8. 2918913Domain d1oi0c_: 1oi0 C: [93047]
    complexed with 144, zn
    missing some secondary structures that made up less than one-third of the common domain

Details for d1oi0c_

PDB Entry: 1oi0 (more details), 1.5 Å

PDB Description: crystal structure of af2198, a jab1/mpn domain protein from archaeoglobus fulgidus
PDB Compounds: (C:) hypothetical protein af2198

SCOPe Domain Sequences for d1oi0c_:

Sequence, based on SEQRES records: (download)

>d1oi0c_ c.97.3.1 (C:) Hypothetical protein AF2198 {Archaeoglobus fulgidus [TaxId: 2234]}
gssmkisrgllktileaaksahpdefiallsgskdvmdeliflpfvsgsvsavihldmlp
igmkvfgtvhshpspscrpseedlslftrfgkyhiivcypydenswkcynrkgeevelev
ve

Sequence, based on observed residues (ATOM records): (download)

>d1oi0c_ c.97.3.1 (C:) Hypothetical protein AF2198 {Archaeoglobus fulgidus [TaxId: 2234]}
gssmkisrgllktileaaksahpdefiallsgskdvmdeliflgmkvfgtvhshpspscr
pseedlslftrfgkyhiivcypydenswkcynrkgeevelevve

SCOPe Domain Coordinates for d1oi0c_:

Click to download the PDB-style file with coordinates for d1oi0c_.
(The format of our PDB-style files is described here.)

Timeline for d1oi0c_: