SCOP 1.69: Domain d1ohza_: 1ohz A:

Lineage for d1ohza_ (1ohz A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (3 families)

5. Family b.2.2.2: Cellulose-binding domain family III [49390] (4 proteins)
   Pfam 00963

6. Protein Cohesin domain [49396] (1 species)

7. Species Clostridium thermocellum, cellulosome, various modules [TaxId:1515] [49397] (4 PDB entries)

8. Domain d1ohza_: 1ohz A: [93043]
   Other proteins in same PDB: d1ohzb_
   complexed with dockerin domain

Details for d1ohza_

PDB Entry: 1ohz, 2.2 Å

PDB Description: cohesin-dockerin complex from the cellulosome of clostridium thermocellum

SCOP Domain Sequences for d1ohza_:

Sequence; same for both SEQRES and ATOM records:

>d1ohza_ b.2.2.2 (A:) Cohesin domain {Clostridium thermocellum, cellulosome, various modules}
gvvveigkvtgsvgttveipvyfrgvpskgiancdfvfrydpnvleiigidpgdiivdpn
ptksfdtaiypdrkiivflfaedsgtgayaitkdgvfakiratvkssapgyitfdevggf
adndlveqkvsfidggvnvg

Timeline for d1ohza_:

• d1ohza_ first appeared in SCOP 1.67
  
• d1ohza_ appears in SCOP 1.71
  
• d1ohza_ appears in the current release, SCOPe 2.08