SCOPe 2.08: Domain d1ohua_: 1ohu A:

Lineage for d1ohua_ (1ohu A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator ced-9 [103424] (1 species)

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [103425] (2 PDB entries)
   Uniprot P41958 74-237

8. Domain d1ohua_: 1ohu A: [93029]

Details for d1ohua_

PDB Entry: 1ohu, 2.03 Å

PDB Description: structure of caenorhabditis elegans ced-9

PDB Compounds: (A:) Apoptosis regulator ced-9

SCOPe Domain Sequences for d1ohua_:

Sequence, based on SEQRES records:

>d1ohua_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
fetfseqllavprisfslyqdvvrtvgnaqtdqspmsygrliglisfggfvaakmmesve
lqgqvrnlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek

Sequence, based on observed residues (ATOM records):

>d1ohua_ f.1.4.1 (A:) Apoptosis regulator ced-9 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
ndweeprldiegfvvdyfthrirqngmewfgapglpsgvqpehemmrvmgtifekkhaen
fetfseqllavprisfslyqdvvrtvgnpmsygrliglisfggfvaakmmesvelqgqvr
nlfvytslfiktrirnnwkehnrswddfmtlgkqmkedyeraeaek

Timeline for d1ohua_:

• d1ohua_ first appeared in SCOP 1.67
  
• d1ohua_ appears in SCOPe 2.07