Lineage for d1ohqa_ (1ohq A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510451Species Engineered (including hybrid species) [88562] (68 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # humanized antibody ! SQ NA # Humanized antibody ! SQ NA # engineered antibody
  8. 1510462Domain d1ohqa_: 1ohq A: [93027]
    soluble VH Hel4, resistant to aggregation

Details for d1ohqa_

PDB Entry: 1ohq (more details), 2 Å

PDB Description: crystal structure of hel4, a soluble human vh antibody domain resistant to aggregation
PDB Compounds: (A:) immunoglobulin

SCOPe Domain Sequences for d1ohqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohqa_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
evqllesggglvqpggslrlscaasgfrisdedmgwvrqapgkglewvssiygpsgstyy
adsvkgrftisrdnskntlylqmnslraedtavyycasaleplseplgfwgqgtlvtvss

SCOPe Domain Coordinates for d1ohqa_:

Click to download the PDB-style file with coordinates for d1ohqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ohqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ohqb_