Lineage for d1ohgb_ (1ohg B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 879326Fold d.183: Major capsid protein gp5 [56562] (1 superfamily)
    unusual fold; contains PF0899-like core, decorated with additional structure
  4. 879327Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) (S)
    possibly related to the hypothetical protein PF0899 superfamily ((111057))
  5. 879328Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein)
  6. 879329Protein Major capsid protein gp5 [56565] (1 species)
  7. 879330Species Bacteriophage HK97 [TaxId:37554] [56566] (5 PDB entries)
  8. 879342Domain d1ohgb_: 1ohg B: [93019]

Details for d1ohgb_

PDB Entry: 1ohg (more details), 3.45 Å

PDB Description: structure of the dsdna bacteriophage hk97 mature empty capsid
PDB Compounds: (B:) Major capsid protein

SCOP Domain Sequences for d1ohgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohgb_ d.183.1.1 (B:) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfssg

SCOP Domain Coordinates for d1ohgb_:

Click to download the PDB-style file with coordinates for d1ohgb_.
(The format of our PDB-style files is described here.)

Timeline for d1ohgb_: