Lineage for d1ohga_ (1ohg A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610977Fold d.183: Major capsid protein gp5 [56562] (1 superfamily)
    unusual fold; contains PF0899-like core, decorated with additional structure
  4. 2610978Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) (S)
    possibly related to the hypothetical protein PF0899 superfamily (111057)
    automatically mapped to Pfam PF05065
  5. 2610979Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein)
  6. 2610980Protein Major capsid protein gp5 [56565] (1 species)
  7. 2610981Species Bacteriophage HK97 [TaxId:37554] [56566] (5 PDB entries)
  8. 2610992Domain d1ohga_: 1ohg A: [93018]
    complexed with cl, so4

Details for d1ohga_

PDB Entry: 1ohg (more details), 3.45 Å

PDB Description: structure of the dsdna bacteriophage hk97 mature empty capsid
PDB Compounds: (A:) Major capsid protein

SCOPe Domain Sequences for d1ohga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohga_ d.183.1.1 (A:) Major capsid protein gp5 {Bacteriophage HK97 [TaxId: 37554]}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfssg

SCOPe Domain Coordinates for d1ohga_:

Click to download the PDB-style file with coordinates for d1ohga_.
(The format of our PDB-style files is described here.)

Timeline for d1ohga_: