Lineage for d1ohga_ (1ohg A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422218Fold d.183: Major capsid protein gp5 [56562] (1 superfamily)
    unusual fold
  4. 422219Superfamily d.183.1: Major capsid protein gp5 [56563] (1 family) (S)
  5. 422220Family d.183.1.1: Major capsid protein gp5 [56564] (1 protein)
  6. 422221Protein Major capsid protein gp5 [56565] (1 species)
  7. 422222Species Bacteriophage HK97 [TaxId:37554] [56566] (1 PDB entry)
  8. 422223Domain d1ohga_: 1ohg A: [93018]

Details for d1ohga_

PDB Entry: 1ohg (more details), 3.45 Å

PDB Description: structure of the dsdna bacteriophage hk97 mature empty capsid

SCOP Domain Sequences for d1ohga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohga_ d.183.1.1 (A:) Major capsid protein gp5 {Bacteriophage HK97}
slgsdadsagsliqpmqipgiimpglrrltirdllaqgrtssnaleyvreevftnnadvv
aekalkpesditfskqtanvktiahwvqasrqvmddapmlqsyinnrlmyglalkeegql
lngdgtgdnleglnkvataydtslnatgdtradiiahaiyqvtesefsasgivlnprdwh
niallkdnegryifggpqaftsnimwglpvvptkaqaagtftvggfdmasqvwdrmdatv
evsredrdnfvknmltilceerlalahyrptaiikgtfssg

SCOP Domain Coordinates for d1ohga_:

Click to download the PDB-style file with coordinates for d1ohga_.
(The format of our PDB-style files is described here.)

Timeline for d1ohga_: