Lineage for d1ohfd_ (1ohf D:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409884Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2410108Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2410719Family b.121.4.8: Tetraviridae-like VP [101568] (1 protein)
    automatically mapped to Pfam PF03566
  6. 2410720Protein Tetraomegavirus capsid protein [101569] (1 species)
    contains an insert beta-sandwich domain
  7. 2410721Species Nudaurelia capensis omega virus [TaxId:12541] [101570] (1 PDB entry)
  8. 2410725Domain d1ohfd_: 1ohf D: [93017]
    complexed with mg

Details for d1ohfd_

PDB Entry: 1ohf (more details), 2.8 Å

PDB Description: the refined structure of nudaurelia capensis omega virus
PDB Compounds: (D:) nudaurelia capensis omega virus capsid protein

SCOPe Domain Sequences for d1ohfd_:

Sequence, based on SEQRES records: (download)

>d1ohfd_ b.121.4.8 (D:) Tetraomegavirus capsid protein {Nudaurelia capensis omega virus [TaxId: 12541]}
idnvtaaaqelgqsldanvitfptnvatmpefrswargkldidqdsigwyfkyldpagat
esaravgeyskipdglvkfsvdaeireiyneecptvsdasipldgaqwslsiisypmfrt
ayfavanvdnkeisldvtndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhpty
dlpdptegllrtvsdyrltyksitceanmptlvdqgfwigghyaltpiattqnavegsgf
vhpfnvtrpgiaagvtltwasmppggsapsgdpawipdsttqfqwrhggfdaptgvityt
iprgytmqyfdtttnewngfanpddvvtfgqtggaagtnatititaptvtltilatttsa
anvinfrnldaettaasnrsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnp
vfqltpassfgaisftnpgfdrnldlpgfggirdsldvnmstavchfrslskscsivtkt
yqgwegvtnvntpfgqfahsgllkndeilcladdlatrltgvygatdnfaaavlafaanm
ltsvlkseattsvikelgnqatglanqglarlpgllasipgkiaarvrarrdrrraarm

Sequence, based on observed residues (ATOM records): (download)

>d1ohfd_ b.121.4.8 (D:) Tetraomegavirus capsid protein {Nudaurelia capensis omega virus [TaxId: 12541]}
idnvtaaaqelgqsldanvitfptnvatmpefrswargkldidqdsigwyfkyldpagat
esaravgeyskipdglvkfsvdaeireiyneecptvsdasipldgaqwslsiisypmfrt
ayfavanvdnkeisldvtndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhpty
dlpdptegllrtvsdyrltyksitceanmptlvdqgfwigghyaltpiattqnavegsgf
vhpfnvtrpgiaagvtltwasmppggsapsgdpawipdsttqfqwrhggfdaptgvityt
iprgytmqyfdtttnewngfanpddvvtfgqtggaagtnatititaptvtltilatttsa
anvinfrnldaettaasnrsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnp
vfqltpassfgaisftnpgfdrnldlpgfggirdsldvnmstavchfrslskscsivtkt
yqgwegvtnvntpfgqfahsgllkndeilcladdlatrltgvygatdnfaaavlafaanm
ltsvlkseattsvikelgnlpgllasipgkiaarvrarrdrrraarm

SCOPe Domain Coordinates for d1ohfd_:

Click to download the PDB-style file with coordinates for d1ohfd_.
(The format of our PDB-style files is described here.)

Timeline for d1ohfd_: