Lineage for d1ohfa_ (1ohf A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382736Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 382819Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 383203Family b.121.4.8: Tetraviridae-like VP [101568] (1 protein)
  6. 383204Protein Tetraomegavirus capsid protein [101569] (1 species)
    contains an insert beta-sandwich domain
  7. 383205Species Nudaurelia capensis omega virus [TaxId:12541] [101570] (1 PDB entry)
  8. 383206Domain d1ohfa_: 1ohf A: [93014]

Details for d1ohfa_

PDB Entry: 1ohf (more details), 2.8 Å

PDB Description: the refined structure of nudaurelia capensis omega virus

SCOP Domain Sequences for d1ohfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohfa_ b.121.4.8 (A:) Tetraomegavirus capsid protein {Nudaurelia capensis omega virus}
vitfptnvatmpefrswargkldidqdsigwyfkyldpagatesaravgeyskipdglvk
fsvdaeireiyneecptvsdasipldgaqwslsiisypmfrtayfavanvdnkeisldvt
ndlivwlnnlaswrdvvdsgqwftfsddptwfvrirvlhptydlpdptegllrtvsdyrl
tyksitceanmptlvdqgfwigghyaltpiattqnavegsgfvhpfnvtrpgiaagvtlt
wasmppggsapsgdpawipdsttqfqwrhggfdaptgvitytiprgytmqyfdtttnewn
gfanpddvvtfgqtggaagtnatititaptvtltilatttsaanvinfrnldaettaasn
rsevplppltfgqtapnnpkieqtlvkdtlgsylvhskmrnpvfqltpassfgaisftnp
gfdrnldlpgfggirdsldvnmstavchfrslskscsivtktyqgwegvtnvntpfgqfa
hsgllkndeilcladdlatrltgvygatdnfaaavlafaanmltsvlkseattsvikel

SCOP Domain Coordinates for d1ohfa_:

Click to download the PDB-style file with coordinates for d1ohfa_.
(The format of our PDB-style files is described here.)

Timeline for d1ohfa_: