Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins) |
Protein N-acetyl-l-glutamate kinase [75298] (4 species) |
Species Escherichia coli [TaxId:562] [75299] (5 PDB entries) |
Domain d1ohba_: 1ohb A: [93013] complexed with act, adp, so4 |
PDB Entry: 1ohb (more details), 1.9 Å
SCOPe Domain Sequences for d1ohba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ohba_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli [TaxId: 562]} mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha eqlpalfngmpmgtrila
Timeline for d1ohba_: