SCOP 1.69: Domain d1oh9a_: 1oh9 A:

Lineage for d1oh9a_ (1oh9 A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (2 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (1 protein)

6. Protein N-acetyl-l-glutamate kinase [75298] (1 species)

7. Species Escherichia coli [TaxId:562] [75299] (5 PDB entries)

8. Domain d1oh9a_: 1oh9 A: [93011]

Details for d1oh9a_

PDB Entry: 1oh9, 1.91 Å

PDB Description: acetylglutamate kinase from escherichia coli complexed with mgadp, n- acetyl-l-glutamate and the transition-state mimic alf4-

SCOP Domain Sequences for d1oh9a_:

Sequence; same for both SEQRES and ATOM records:

>d1oh9a_ c.73.1.2 (A:) N-acetyl-l-glutamate kinase {Escherichia coli}
mmnpliiklggvlldseealerlfsalvnyreshqrplvivhgggcvvdelmkglnlpvk
kknglrvtpadqidiitgalagtanktllawakkhqiaavglflgdgdsvkvtqldeelg
hvglaqpgspklinsllengylpvvssigvtdegqlmnvnadqaatalaatlgadlills
dvsgildgkgqriaemtaakaeqlieqgiitdgmivkvnaaldaartlgrpvdiaswrha
eqlpalfngmpmgtrila

Timeline for d1oh9a_:

• d1oh9a_ first appeared in SCOP 1.67
  
• d1oh9a_ appears in SCOP 1.71
  
• d1oh9a_ appears in the current release, SCOPe 2.08