Class a: All alpha proteins [46456] (226 folds) |
Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) |
Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein) |
Protein DNA repair protein MutS, domain III [48336] (2 species) |
Species Escherichia coli [TaxId:562] [48338] (7 PDB entries) |
Domain d1oh8b1: 1oh8 B:270-566 [93007] Other proteins in same PDB: d1oh8a2, d1oh8a3, d1oh8a4, d1oh8b2, d1oh8b3, d1oh8b4 complexed with adp, mo4 |
PDB Entry: 1oh8 (more details), 2.9 Å
SCOP Domain Sequences for d1oh8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh8b1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli} daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1oh8b1:
View in 3D Domains from other chains: (mouse over for more information) d1oh8a1, d1oh8a2, d1oh8a3, d1oh8a4 |