SCOPe 2.05: Domain d1oh8a4: 1oh8 A:2-116

Lineage for d1oh8a4 (1oh8 A:2-116)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families)
   automatically mapped to Pfam PF01624

5. Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)

6. Protein DNA repair protein MutS, domain I [55273] (2 species)

7. Species Escherichia coli [TaxId:562] [55275] (8 PDB entries)
   Uniprot P23909 2-800

8. Domain d1oh8a4: 1oh8 A:2-116 [93006]
   Other proteins in same PDB: d1oh8a1, d1oh8a2, d1oh8a3, d1oh8b1, d1oh8b2, d1oh8b3
   complexed with adp, mg

Details for d1oh8a4

PDB Entry: 1oh8, 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an unpaired thymidine

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh8a4:

Sequence; same for both SEQRES and ATOM records:

>d1oh8a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

Timeline for d1oh8a4:

• d1oh8a4 first appeared in SCOP 1.67
  
• d1oh8a4 appears in SCOPe 2.04
  
• d1oh8a4 appears in SCOPe 2.06
  
• d1oh8a4 appears in the current release, SCOPe 2.08