Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) |
Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein) |
Protein DNA repair protein MutS, domain I [55273] (2 species) |
Species Escherichia coli [TaxId:562] [55275] (7 PDB entries) |
Domain d1oh8a4: 1oh8 A:2-116 [93006] Other proteins in same PDB: d1oh8a1, d1oh8a2, d1oh8a3, d1oh8b1, d1oh8b2, d1oh8b3 |
PDB Entry: 1oh8 (more details), 2.9 Å
SCOP Domain Sequences for d1oh8a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh8a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli} saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp
Timeline for d1oh8a4:
View in 3D Domains from other chains: (mouse over for more information) d1oh8b1, d1oh8b2, d1oh8b3, d1oh8b4 |