SCOP 1.71: Domain d1oh8a3: 1oh8 A:117-269

Lineage for d1oh8a3 (1oh8 A:117-269)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family)

5. Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)

6. Protein DNA repair protein MutS, domain II [53152] (2 species)

7. Species Escherichia coli [TaxId:562] [53154] (7 PDB entries)

8. Domain d1oh8a3: 1oh8 A:117-269 [93005]
   Other proteins in same PDB: d1oh8a1, d1oh8a2, d1oh8a4, d1oh8b1, d1oh8b2, d1oh8b4

Details for d1oh8a3

PDB Entry: 1oh8, 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an unpaired thymidine

SCOP Domain Sequences for d1oh8a3:

Sequence; same for both SEQRES and ATOM records:

>d1oh8a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

Timeline for d1oh8a3:

• d1oh8a3 first appeared in SCOP 1.67
  
• d1oh8a3 appears in SCOP 1.69
  
• d1oh8a3 appears in SCOP 1.73
  
• d1oh8a3 appears in the current release, SCOPe 2.08