SCOPe 2.07: Domain d1oh8a1: 1oh8 A:270-566

Lineage for d1oh8a1 (1oh8 A:270-566)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
   multihelical; consists of 2 all-alpha subdomains

4. Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families)

5. Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)

6. Protein DNA repair protein MutS, domain III [48336] (2 species)

7. Species Escherichia coli [TaxId:562] [48338] (8 PDB entries)
   Uniprot P23909 2-800

8. Domain d1oh8a1: 1oh8 A:270-566 [93003]
   Other proteins in same PDB: d1oh8a2, d1oh8a3, d1oh8a4, d1oh8b2, d1oh8b3, d1oh8b4
   complexed with adp, mg

Details for d1oh8a1

PDB Entry: 1oh8, 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an unpaired thymidine

PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh8a1:

Sequence; same for both SEQRES and ATOM records:

>d1oh8a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

Timeline for d1oh8a1:

• d1oh8a1 first appeared in SCOP 1.67
  
• d1oh8a1 appears in SCOPe 2.06
  
• d1oh8a1 appears in the current release, SCOPe 2.08