Lineage for d1oh7a4 (1oh7 A:2-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958380Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (2 families) (S)
    automatically mapped to Pfam PF01624
  5. 2958381Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 2958382Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 2958383Species Escherichia coli [TaxId:562] [55275] (8 PDB entries)
    Uniprot P23909 2-800
  8. 2958391Domain d1oh7a4: 1oh7 A:2-116 [92998]
    Other proteins in same PDB: d1oh7a1, d1oh7a2, d1oh7a3, d1oh7b1, d1oh7b2, d1oh7b3
    complexed with adp, mg

Details for d1oh7a4

PDB Entry: 1oh7 (more details), 2.5 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a g:g mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh7a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh7a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOPe Domain Coordinates for d1oh7a4:

Click to download the PDB-style file with coordinates for d1oh7a4.
(The format of our PDB-style files is described here.)

Timeline for d1oh7a4: