Lineage for d1oh6b1 (1oh6 B:270-566)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542557Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 542558Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) (S)
  5. 542559Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 542560Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 542561Species Escherichia coli [TaxId:562] [48338] (7 PDB entries)
  8. 542567Domain d1oh6b1: 1oh6 B:270-566 [92991]
    Other proteins in same PDB: d1oh6a2, d1oh6a3, d1oh6a4, d1oh6b2, d1oh6b3, d1oh6b4
    complexed with adp, mo4

Details for d1oh6b1

PDB Entry: 1oh6 (more details), 2.4 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an a:a mismatch

SCOP Domain Sequences for d1oh6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh6b1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOP Domain Coordinates for d1oh6b1:

Click to download the PDB-style file with coordinates for d1oh6b1.
(The format of our PDB-style files is described here.)

Timeline for d1oh6b1: