Lineage for d1oh6a4 (1oh6 A:2-116)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727129Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 727160Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 727161Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 727162Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 727163Species Escherichia coli [TaxId:562] [55275] (10 PDB entries)
  8. 727169Domain d1oh6a4: 1oh6 A:2-116 [92990]
    Other proteins in same PDB: d1oh6a1, d1oh6a2, d1oh6a3, d1oh6b1, d1oh6b2, d1oh6b3

Details for d1oh6a4

PDB Entry: 1oh6 (more details), 2.4 Å

PDB Description: the crystal structure of e. coli muts binding to dna with an a:a mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOP Domain Sequences for d1oh6a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh6a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli [TaxId: 562]}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOP Domain Coordinates for d1oh6a4:

Click to download the PDB-style file with coordinates for d1oh6a4.
(The format of our PDB-style files is described here.)

Timeline for d1oh6a4: