| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily) multihelical; consists of 2 all-alpha subdomains |
Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (1 family) ![]() |
| Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein) |
| Protein DNA repair protein MutS, domain III [48336] (2 species) |
| Species Escherichia coli [TaxId:562] [48338] (6 PDB entries) |
| Domain d1oh5b1: 1oh5 B:270-566 [92983] Other proteins in same PDB: d1oh5a2, d1oh5a3, d1oh5a4, d1oh5b2, d1oh5b3, d1oh5b4 complexed with adp, mo4 |
PDB Entry: 1oh5 (more details), 2.9 Å
SCOP Domain Sequences for d1oh5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh5b1 a.113.1.1 (B:270-566) DNA repair protein MutS, domain III {Escherichia coli}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
Timeline for d1oh5b1:
View in 3DDomains from other chains: (mouse over for more information) d1oh5a1, d1oh5a2, d1oh5a3, d1oh5a4 |