Lineage for d1oh5a4 (1oh5 A:2-116)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414051Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 414074Superfamily d.75.2: DNA repair protein MutS, domain I [55271] (1 family) (S)
  5. 414075Family d.75.2.1: DNA repair protein MutS, domain I [55272] (1 protein)
  6. 414076Protein DNA repair protein MutS, domain I [55273] (2 species)
  7. 414077Species Escherichia coli [TaxId:562] [55275] (6 PDB entries)
  8. 414088Domain d1oh5a4: 1oh5 A:2-116 [92982]
    Other proteins in same PDB: d1oh5a1, d1oh5a2, d1oh5a3, d1oh5b1, d1oh5b2, d1oh5b3

Details for d1oh5a4

PDB Entry: 1oh5 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a c:a mismatch

SCOP Domain Sequences for d1oh5a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh5a4 d.75.2.1 (A:2-116) DNA repair protein MutS, domain I {Escherichia coli}
saienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrgas
agepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtp

SCOP Domain Coordinates for d1oh5a4:

Click to download the PDB-style file with coordinates for d1oh5a4.
(The format of our PDB-style files is described here.)

Timeline for d1oh5a4: