Lineage for d1oh5a3 (1oh5 A:117-269)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 587134Superfamily c.55.6: DNA repair protein MutS, domain II [53150] (1 family) (S)
  5. 587135Family c.55.6.1: DNA repair protein MutS, domain II [53151] (1 protein)
  6. 587136Protein DNA repair protein MutS, domain II [53152] (2 species)
  7. 587137Species Escherichia coli [TaxId:562] [53154] (7 PDB entries)
  8. 587150Domain d1oh5a3: 1oh5 A:117-269 [92981]
    Other proteins in same PDB: d1oh5a1, d1oh5a2, d1oh5a4, d1oh5b1, d1oh5b2, d1oh5b4

Details for d1oh5a3

PDB Entry: 1oh5 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a c:a mismatch
PDB Compounds: (A:)

SCOP Domain Sequences for d1oh5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh5a3 c.55.6.1 (A:117-269) DNA repair protein MutS, domain II {Escherichia coli}
gtisdeallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpa
ellyaedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglca
agcllqyakdtqrttlphirsitmereqdsiim

SCOP Domain Coordinates for d1oh5a3:

Click to download the PDB-style file with coordinates for d1oh5a3.
(The format of our PDB-style files is described here.)

Timeline for d1oh5a3: