Lineage for d1oh5a1 (1oh5 A:270-566)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1744927Fold a.113: DNA repair protein MutS, domain III [48333] (1 superfamily)
    multihelical; consists of 2 all-alpha subdomains
  4. 1744928Superfamily a.113.1: DNA repair protein MutS, domain III [48334] (2 families) (S)
  5. 1744929Family a.113.1.1: DNA repair protein MutS, domain III [48335] (1 protein)
  6. 1744930Protein DNA repair protein MutS, domain III [48336] (2 species)
  7. 1744931Species Escherichia coli [TaxId:562] [48338] (8 PDB entries)
    Uniprot P23909 2-800
  8. 1744945Domain d1oh5a1: 1oh5 A:270-566 [92979]
    Other proteins in same PDB: d1oh5a2, d1oh5a3, d1oh5a4, d1oh5b2, d1oh5b3, d1oh5b4
    complexed with adp, mg

Details for d1oh5a1

PDB Entry: 1oh5 (more details), 2.9 Å

PDB Description: the crystal structure of e. coli muts binding to dna with a c:a mismatch
PDB Compounds: (A:) DNA mismatch repair protein muts

SCOPe Domain Sequences for d1oh5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oh5a1 a.113.1.1 (A:270-566) DNA repair protein MutS, domain III {Escherichia coli [TaxId: 562]}
daatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqqtig
alqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvdsap
vqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdyler
levrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipelkey
edkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln

SCOPe Domain Coordinates for d1oh5a1:

Click to download the PDB-style file with coordinates for d1oh5a1.
(The format of our PDB-style files is described here.)

Timeline for d1oh5a1: