![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
![]() | Superfamily b.61.2: beta-Barrel protease inhibitors [50882] (3 families) ![]() |
![]() | Family b.61.2.2: Staphostatin [101869] (2 proteins) cysteine protease inhibitor; topology permutation: strand 3 is replaced with the N-terminal extra strand |
![]() | Protein Staphostatin A (SAV1910, SA1726) [101870] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [101871] (1 PDB entry) |
![]() | Domain d1oh1a_: 1oh1 A: [92977] |
PDB Entry: 1oh1 (more details)
SCOPe Domain Sequences for d1oh1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oh1a_ b.61.2.2 (A:) Staphostatin A (SAV1910, SA1726) {Staphylococcus aureus [TaxId: 1280]} gsmeqfelfsidkfkcnseakyylniiegewhpqdlndsplkfilstsddsdyickyint ehkqltlynknnssivieifipndnkilltimntealgtsprmtfikhk
Timeline for d1oh1a_: