Lineage for d1ogyn_ (1ogy N:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 778525Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
    variable number of helices and little beta structure; not a true fold
  4. 778526Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) (S)
    duplication: contains multiple CxxCH motifs
  5. 778614Family a.138.1.3: Di-heme elbow motif [48711] (7 proteins)
    the main characteristic feature of this motif is the packing of its two hemes
    many members contains one or more complete motifs flanked by incomplete motifs and/or other domains
  6. 778695Protein Periplasmic nitrate reductase subunit NapB [74805] (2 species)
  7. 778698Species Rhodobacter sphaeroides [TaxId:1063] [101503] (1 PDB entry)
  8. 778705Domain d1ogyn_: 1ogy N: [92972]
    Other proteins in same PDB: d1ogya1, d1ogya2, d1ogyc1, d1ogyc2, d1ogye1, d1ogye2, d1ogyg1, d1ogyg2, d1ogyi1, d1ogyi2, d1ogyk1, d1ogyk2, d1ogym1, d1ogym2, d1ogyo1, d1ogyo2

Details for d1ogyn_

PDB Entry: 1ogy (more details), 3.2 Å

PDB Description: crystal structure of the heterodimeric nitrate reductase from rhodobacter sphaeroides
PDB Compounds: (N:) nitrate reductase

SCOP Domain Sequences for d1ogyn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ogyn_ a.138.1.3 (N:) Periplasmic nitrate reductase subunit NapB {Rhodobacter sphaeroides [TaxId: 1063]}
daprltgadrpmsevaapplpetitddrrvgrnypeqppviphsiegyqlsvnanrclec
hrrqysglvaapmisithfqdregqmladvsprryfctachvpqtnaqplvtnefrdmlt
lmpasne

SCOP Domain Coordinates for d1ogyn_:

Click to download the PDB-style file with coordinates for d1ogyn_.
(The format of our PDB-style files is described here.)

Timeline for d1ogyn_: